Request QuoteCatalog Number: xP491827HTDSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein HAPS_1040 (HAPS_1040)

Recombinant UPF0133 protein HAPS_1040 (HAPS_1040) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP491827HTDYeast1mgQuote
EP491827HTDE. coli1mgQuote
BP491827HTDBaculovirus200ugQuote
MP491827HTDMammalian Cell200ugQuote

Protein Information

SpeciesHaemophilus parasuis serovar 5 (strain SH0165)
UniProt IDB8F5Q7
Gene NameLocus:HAPS_1040
Protein NameUPF0133 protein HAPS_1040
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMFGKGGLGGLMKQAQQMQERMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRIEIDPS LMEDDKEMAEDLVAAAFNDAVRRADEMQKEKMASVTAGMQLPPGMKFPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review