Request QuoteCatalog Number: xP490449DKJSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein Dtur_0258 (Dtur_0258)

Recombinant UPF0133 protein Dtur_0258 (Dtur_0258) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490449DKJYeast1mgQuote
EP490449DKJE. coli1mgQuote
BP490449DKJBaculovirus200ugQuote
MP490449DKJMammalian Cell200ugQuote

Protein Information

SpeciesDictyoglomus turgidum (strain Z-1310 / DSM 6724)
UniProt IDB8E1Q9
Gene NameLocus:Dtur_0258
Protein NameUPF0133 protein Dtur_0258
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMKNPFEAMKQLKKLQEKMAKIEEELEQTLVEGTAGGGVVKIVMTAKEEVKEVKIDPEVVN KDEVDILEDLIAAALRDALTKAKEKSAEKMGSLTDGLPLPPGLF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review