Request QuoteCatalog Number: xP461358DSYSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein Ctha_1157 (Ctha_1157)

Recombinant UPF0133 protein Ctha_1157 (Ctha_1157) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP461358DSYYeast1mgQuote
EP461358DSYE. coli1mgQuote
BP461358DSYBaculovirus200ugQuote
MP461358DSYMammalian Cell200ugQuote

Protein Information

SpeciesChloroherpeton thalassium (strain ATCC 35110 / GB-78)
UniProt IDB3QYJ3
Gene NameLocus:Ctha_1157
Protein Name
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMQLGDMSAMLKQVQQMSEKMQEAQKQLESMTAIGESGGGLVKAMANGKHEIISIQIDKDV LDDVDMLQDLIVAAVNQALTEATKMAQEEMSKVTGGMMGDMNFLKNLNMGG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review