Request QuoteCatalog Number: xP461320DSQSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein Cpar_0834 (Cpar_0834)

Recombinant UPF0133 protein Cpar_0834 (Cpar_0834) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP461320DSQYeast1mgQuote
EP461320DSQE. coli1mgQuote
BP461320DSQBaculovirus200ugQuote
MP461320DSQMammalian Cell200ugQuote

Protein Information

SpeciesChlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )
UniProt IDB3QMU7
Gene NameLocus:Cpar_0834
Protein Name
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMAMPNFGDMMKQLQEAGAKMQDVQKQLEKLVSEGEAGGGMVKAKVNGRQKLLELSIDPEI MDDVDMVQDLVVAAVNKALDASAQLAQNEIQKAAGGMINPADLLKQFGGQG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review