Request QuoteCatalog Number: xP463021DSRSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein Clim_0875 (Clim_0875)

Recombinant UPF0133 protein Clim_0875 (Clim_0875) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP463021DSRYeast1mgQuote
EP463021DSRE. coli1mgQuote
BP463021DSRBaculovirus200ugQuote
MP463021DSRMammalian Cell200ugQuote

Protein Information

SpeciesChlorobium limicola (strain DSM 245 / NBRC 103803)
UniProt IDB3EIC4
Gene NameLocus:Clim_0875
Protein Name
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMGMPNLGDMMKQIQKAGEKMQDVQNQLEKLVAHGESGGGMVKVSVSGKQKLLSLRIDPEI MDDAEMVQDLVIAAVNNALDASAALAQEEISKAAGGMINPADILKNMNLGK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review