Request QuoteCatalog Number: xP491966DQPSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein CCNA_00269 (CCNA_00269)

Recombinant UPF0133 protein CCNA_00269 (CCNA_00269) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP491966DQPYeast1mgQuote
EP491966DQPE. coli1mgQuote
BP491966DQPBaculovirus200ugQuote
MP491966DQPMammalian Cell200ugQuote

Protein Information

SpeciesCaulobacter crescentus (strain NA1000 / CB15N)
UniProt IDB8GYD9
Gene NameLocus:CCNA_00269
Protein NameUPF0133 protein CCNA_00269
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMKDLGGLMKQAQAMQQKLADAQARLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQ PGEGEVIADLIIAAHADAKKKLDAKQAQMMQDAAGPMAGLMGGLPGMKF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review