Request QuoteCatalog Number: xP492894BXASize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein BUAPTUC7_476 (BUAPTUC7_476)

Recombinant UPF0133 protein BUAPTUC7_476 (BUAPTUC7_476) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492894BXAYeast1mgQuote
EP492894BXAE. coli1mgQuote
BP492894BXABaculovirus200ugQuote
MP492894BXAMammalian Cell200ugQuote

Protein Information

SpeciesBuchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
UniProt IDB8D811
Gene NameLocus:BUAPTUC7_476
Protein NameUPF0133 protein BUAPTUC7_476
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMFTKGGLGNLMKQAQQMQEKMAKIQEEIAQMEVTGEAGAGLVKVTINGAHNCRRVEVDPS LLQDDKDMLEDLAAAAFNDATRRISEVQKKKMSAISTGMQLPNGFNMPV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review