Request QuoteCatalog Number: xP507954BWTSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein BMEA_A0033 (BMEA_A0033)

Recombinant UPF0133 protein BMEA_A0033 (BMEA_A0033) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP507954BWTYeast1mgQuote
EP507954BWTE. coli1mgQuote
BP507954BWTBaculovirus200ugQuote
MP507954BWTMammalian Cell200ugQuote

Protein Information

SpeciesBrucella melitensis biotype 2 (strain ATCC 23457)
UniProt IDC0RG97
Gene NameLocus:BMEA_A0033
Protein NameUPF0133 protein BMEA_A0033
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMK EDEVEILEDLIIAAHNDGKAKLEAAMAEKTQSLTAGLPIPPGFKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review