Request QuoteCatalog Number: xP382801SUQSize: 0.2-1mg

Request Quote

Recombinant UPF0122 protein SpyM50882 (SpyM50882)

Recombinant UPF0122 protein SpyM50882 (SpyM50882) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP382801SUQYeast1mgQuote
EP382801SUQE. coli1mgQuote
BP382801SUQBaculovirus200ugQuote
MP382801SUQMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pyogenes serotype M5 (strain Manfredo)
UniProt IDA2RED5
Gene NameLocus:SpyM50882
Protein NameUPF0122 protein SpyM50882
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMNIMEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIK RTEKILETYEMKLHMYSDYVVRSEIFDDMIAHYPHDEYLQEKISILTSIDNRE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review