Request QuoteCatalog Number: xP498792FMISize: 0.2-1mg

Request Quote

Recombinant UPF0122 protein SEQ_1180 (SEQ_1180)

Recombinant UPF0122 protein SEQ_1180 (SEQ_1180) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP498792FMIYeast1mgQuote
EP498792FMIE. coli1mgQuote
BP498792FMIBaculovirus200ugQuote
MP498792FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0M9C0
Gene NameLocus:SEQ_1180
Protein NameUPF0122 protein SEQ_1180
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTE KILEAYEMKLHMYSDYIVRSEIFDDILAKYPSDHYLRDKISILTSIDNRD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review