Request QuoteCatalog Number: xP513271EOXSize: 0.2-1mg

Request Quote

Recombinant UPF0122 protein EUBREC_1504 (EUBREC_1504)

Recombinant UPF0122 protein EUBREC_1504 (EUBREC_1504) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513271EOXYeast1mgQuote
EP513271EOXE. coli1mgQuote
BP513271EOXBaculovirus200ugQuote
MP513271EOXMammalian Cell200ugQuote

Protein Information

SpeciesEubacterium rectale (strain ATCC 33656 / VPI 0990)
UniProt IDC4Z927
Gene NameLocus:EUBREC_1504
Protein NameUPF0122 protein EUBREC_1504
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceMEEKLEQAYLYDFYGELLNEHQRQVYEDFVFNDLSLGEIASEEGISRQGVADLIKRCNKK LLDYEAKLHLVEKFMSIKSDIRRIHELTNDFKKSHNELLMNEIEAISNQILEEL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review