Request QuoteCatalog Number: xP506523EUASize: 0.2-1mg

Request Quote

Recombinant UPF0102 protein PERMA_0362 (PERMA_0362)

Recombinant UPF0102 protein PERMA_0362 (PERMA_0362) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP506523EUAYeast1mgQuote
EP506523EUAE. coli1mgQuote
BP506523EUABaculovirus200ugQuote
MP506523EUAMammalian Cell200ugQuote

Protein Information

SpeciesPersephonella marina (strain DSM 14350 / EX-H1)
UniProt IDC0QTY9
Gene NameLocus:PERMA_0362
Protein NameUPF0102 protein PERMA_0362
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMFSWIKGKEGEDKAVEYLRNSGYRILERNFRSRFGEIDIIAEDNGTIVIVEVRSKGSTGY GYPEESIDHKKVRKIIKTAQFYLLKRDIKGKQVRFDIISIVNNNIFHIKNAFDLDY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review