Request QuoteCatalog Number: xP510167KBRSize: 0.2-1mg

Request Quote

Recombinant UPF0102 protein Kole_1919 (Kole_1919)

Recombinant UPF0102 protein Kole_1919 (Kole_1919) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP510167KBRYeast1mgQuote
EP510167KBRE. coli1mgQuote
BP510167KBRBaculovirus200ugQuote
MP510167KBRMammalian Cell200ugQuote

Protein Information

SpeciesKosmotoga olearia (strain TBF 19.5.1)
UniProt IDC5CGT1
Gene NameLocus:Kole_1919
Protein NameUPF0102 protein Kole_1919
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMDDMSLKKGKEFEERASKFLKKQGYKILARNVRYSFGELDIVARKGKTLVFVEVKGGNPD FPPRMRVDRAKLRRLELAAYKYIKDFSPKFEESRLDVIEVLSNGEINHLKGVGRW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review