Request QuoteCatalog Number: xP383300BPPSize: 0.2-1mg

Request Quote

Recombinant UPF0060 membrane protein BMA10229_A0598 (BMA10229_A0598)

Recombinant UPF0060 membrane protein BMA10229_A0598 (BMA10229_A0598) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP383300BPPYeast1mgQuote
EP383300BPPE. coli1mgQuote
BP383300BPPBaculovirus200ugQuote
MP383300BPPMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia mallei (strain NCTC 10229)
UniProt IDA2S3S4
Gene NameLocus:BMA10229_A0598
Protein NameUPF0060 membrane protein BMA10229_A0598
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review