Request QuoteCatalog Number: xP463259RLVSize: 0.2-1mg

Request Quote

Recombinant UPF0060 membrane protein Rpal_4363 (Rpal_4363)

Recombinant UPF0060 membrane protein Rpal_4363 (Rpal_4363) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP463259RLVYeast1mgQuote
EP463259RLVE. coli1mgQuote
BP463259RLVBaculovirus200ugQuote
MP463259RLVMammalian Cell200ugQuote

Protein Information

SpeciesRhodopseudomonas palustris (strain TIE-1)
UniProt IDB3QI59
Gene NameLocus:Rpal_4363
Protein Name
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMTSLLTFCAAALMEITGCFAFWAWLRLDKSPLWLIPGMLALALFAYLLTLADSPLAGRAY AAYGGIYIASALLWGWAIEGNRPDQWDVIGAAICLVGMSVILFGPRALPA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review