Request QuoteCatalog Number: xP385939MNXSize: 0.2-1mg

Request Quote

Recombinant UPF0060 membrane protein Mpe_A1656 (Mpe_A1656)

Recombinant UPF0060 membrane protein Mpe_A1656 (Mpe_A1656) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP385939MNXYeast1mgQuote
EP385939MNXE. coli1mgQuote
BP385939MNXBaculovirus200ugQuote
MP385939MNXMammalian Cell200ugQuote

Protein Information

SpeciesMethylibium petroleiphilum (strain PM1)
UniProt IDA2SGC9
Gene NameLocus:Mpe_A1656
Protein NameUPF0060 membrane protein Mpe_A1656
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMLDFLRVTGLFFVTAVAEIVGCYLPWLVLTQGRSAWLLVPAAASLAVFAWLLTLHPSAAG RTYAAYGGVYVVVALLWLWRVDGVVPTRWDLVGGAICLAGMAIIALQPRAAS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review