Request QuoteCatalog Number: xP515364HTASize: 0.2-1mg

Request Quote

Recombinant Uncharacterized transposase-like protein HI_0493 (HI_0493)

Recombinant Uncharacterized transposase-like protein HI_0493 (HI_0493) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515364HTAYeast1mgQuote
EP515364HTAE. coli1mgQuote
BP515364HTABaculovirus200ugQuote
MP515364HTAMammalian Cell200ugQuote

Protein Information

SpeciesHaemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
UniProt IDO05023
Gene NameLocus:HI_0493
Protein NameUncharacterized transposase-like protein HI_0493
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMRGRTRIGKFTTCGERNPKKVARTQPTKKDLKTQNPILHSDQGWLYQMVGYQAILRENSI QQNMSRKGNYLDNNAMENFFGRLKTECYYDKRFETFKQLKKQLMSIFIITTMITFRGN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review