Request QuoteCatalog Number: xP340652BRJSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein yqxJ (yqxJ)

Recombinant Uncharacterized protein yqxJ (yqxJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340652BRJYeast1mgQuote
EP340652BRJE. coli1mgQuote
BP340652BRJBaculovirus200ugQuote
MP340652BRJMammalian Cell200ugQuote

Protein Information

SpeciesBacillus subtilis (strain 168)
UniProt IDP24809
Gene NameyqxJ; aka: yqdF; Locus:BSU25880
Protein NameUncharacterized protein yqxJ
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYDLSEKQYQELRELTSQ YTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGPEEGFGFSKALHNHFFN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review