Request QuoteCatalog Number: xP340717SVGSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein YCR050C (YCR050C)

Recombinant Uncharacterized protein YCR050C (YCR050C) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340717SVGYeast1mgQuote
EP340717SVGE. coli1mgQuote
BP340717SVGBaculovirus200ugQuote
MP340717SVGMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
UniProt IDP25630
Gene NameLocus:YCR050C; ORFs:YCR50C
Protein NameUncharacterized protein YCR050C
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMVAVHKVRYNVIMILGPEQTPNEKTTLDNCGLARRNLVLLKAVHTNCDSWNMNRYPLTLL KMANMAISWNTALKKKVNNVAWLLLKCNAPMELWYTCLSKNL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review