Request QuoteCatalog Number: xP520847MVZSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein Rv3126c/MT3211 (Rv3126c, MT3211)

Recombinant Uncharacterized protein Rv3126c/MT3211 (Rv3126c, MT3211) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520847MVZYeast1mgQuote
EP520847MVZE. coli1mgQuote
BP520847MVZBaculovirus200ugQuote
MP520847MVZMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium tuberculosis
UniProt IDO05799
Gene NameLocus:Rv3126c, MT3211
Protein NameUncharacterized protein Rv3126c/MT3211
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPER DRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review