Request QuoteCatalog Number: xP389176HUSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein LOC154872

Recombinant Uncharacterized protein LOC154872 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP389176HUYeast1mgQuote
EP389176HUE. coli1mgQuote
BP389176HUBaculovirus200ugQuote
MP389176HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA4D0Y5
Gene Name
Protein NameUncharacterized protein LOC154872
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMGAERVCTKAPEITQDEAEIYSLTNMEGNIGIKGCEFKSWLFKFYQARSQVLLCGEVKNP YLLTSNKTTVKEQNACLTHPDRSAMAGLLL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review