Request QuoteCatalog Number: xP002283OFFSize: 0.2-1mg

Request Quote

Recombinant Ubiquitin-like protein ATG12 (ATG12)

Recombinant Ubiquitin-like protein ATG12 (ATG12) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002283OFFYeast1mgQuote
EP002283OFFE. coli1mgQuote
BP002283OFFBaculovirus200ugQuote
MP002283OFFMammalian Cell200ugQuote

Protein Information

SpeciesOryza sativa subsp. indica (Rice)
UniProt IDA2YAG8
Gene NameATG12; aka: APG12; ORFs:OsI_021311
Protein NameUbiquitin-like protein ATG12
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMAAVAAEQKKVVVHFRSTGNAPQLKQSKFKIGGNEKFLKIIDFLRRQIHQDTVFLYVNSA FSPNPDELIIDLYNNFGIDGQLVVNYASSMAWG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review