Request QuoteCatalog Number: xP340958SQWSize: 0.2-1mg

Request Quote

Recombinant Tyrosine-protein phosphatase 16 (STY-16)

Recombinant Tyrosine-protein phosphatase 16 (STY-16) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340958SQWYeast1mgQuote
EP340958SQWE. coli1mgQuote
BP340958SQWBaculovirus200ugQuote
MP340958SQWMammalian Cell200ugQuote

Protein Information

SpeciesStyela plicata (Sea squirt) (Ascidia plicata)
UniProt IDP28208
Gene NameSTY-16
Protein NameTyrosine-protein phosphatase 16
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceWRMVTEHTSTVIVMLTGLVEKGKKKCEKYWPDLGRRATYGQIALKTVDETHVGSYIKRML EITSNGKMQFIHHFQFTSWPDYGVPVATSDLFRFHKAVTRIKTQKPIVV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review