Request QuoteCatalog Number: xP340957SQWSize: 0.2-1mg

Request Quote

Recombinant Tyrosine-protein phosphatase 7 (STY-7)

Recombinant Tyrosine-protein phosphatase 7 (STY-7) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340957SQWYeast1mgQuote
EP340957SQWE. coli1mgQuote
BP340957SQWBaculovirus200ugQuote
MP340957SQWMammalian Cell200ugQuote

Protein Information

SpeciesStyela plicata (Sea squirt) (Ascidia plicata)
UniProt IDP28199
Gene NameSTY-7
Protein NameTyrosine-protein phosphatase 7
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceNNVTIIVMITNLLENGRKKCDQYWPHDGREQYKHISVTLRDVDIYANYIVRSFQLRNTKL SKRRSRNNERRILQYHYTQWPDHGTPEYILPLLKFIRISSVVSSPESGPIVV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review