Request QuoteCatalog Number: xP002408HUSize: 0.2-1mg

Request Quote

Recombinant V-type proton ATPase subunit G 1 (ATP6V1G1)

Recombinant V-type proton ATPase subunit G 1 (ATP6V1G1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002408HUYeast1mgQuote
EP002408HUE. coli1mgRP001344h
BP002408HUBaculovirus200ugQuote
MP002408HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO75348
Gene NameATP6V1G1; aka: ATP6G, ATP6G1, ATP6J
Protein NameV-type proton ATPase subunit G 1
Region Expressed2-118
Expression Tag6xHis
Purity>90%
AA SequenceASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAA ALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review