Request QuoteCatalog Number: xP002407SXVSize: 0.2-1mg

Request Quote

Recombinant V-type proton ATPase subunit F (vma7)

Recombinant V-type proton ATPase subunit F (vma7) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002407SXVYeast1mgQuote
EP002407SXVE. coli1mgQuote
BP002407SXVBaculovirus200ugQuote
MP002407SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO43046
Gene Namevma7; ORFs:SPBC3B9.18c
Protein NameV-type proton ATPase subunit F
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMSSQSYRERTLVSVIGDDDTVTGMLLAGTGQVNENGDKNFFIITQKTTDEQIAEAFDDYT TKRKDIAIVLINQFAAERIRDRIENHVQAFPAVLEIPSKDDPYDPEKDSILRRVRKIIGE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review