Request QuoteCatalog Number: xP492555MSPSize: 0.2-1mg

Request Quote

Recombinant V-type ATP synthase subunit F (atpF)

Recombinant V-type ATP synthase subunit F (atpF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492555MSPYeast1mgQuote
EP492555MSPE. coli1mgQuote
BP492555MSPBaculovirus200ugQuote
MP492555MSPMammalian Cell200ugQuote

Protein Information

SpeciesMethanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
UniProt IDB8GFQ9
Gene NameatpF; Locus:Mpal_2678
Protein NameV-type ATP synthase subunit F
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMEIAVIGNSEFILGFRLAGIRKTYAATDDERLHEHITSVLQDPEVGILVLNSTDMERLPR RLQSTLENSVRPTVIAIGGSEGDMSLREKIKRSVGVDLWK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review