Request QuoteCatalog Number: xP511500ENUSize: 0.2-1mg

Request Quote

Recombinant Trp operon repressor (trpR)

Recombinant Trp operon repressor (trpR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511500ENUYeast1mgQuote
EP511500ENUE. coli1mgQuote
BP511500ENUBaculovirus200ugQuote
MP511500ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZT75
Gene NametrpR; Locus:BWG_4085
Protein NameTrp operon repressor
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review