Request QuoteCatalog Number: xP459503HUSize: 0.2-1mg

Request Quote

Recombinant Transmembrane protein 233 (TMEM233)

Recombinant Transmembrane protein 233 (TMEM233) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP459503HUYeast1mgQuote
EP459503HUE. coli1mgQuote
BP459503HUBaculovirus200ugQuote
MP459503HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDB4DJY2
Gene NameTMEM233; aka: IFITMD2
Protein Name
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFS IMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review