Request QuoteCatalog Number: xP010000NFSSize: 0.2-1mg

Request Quote

Recombinant Transcription initiation factor IIA subunit 2 (toa2)

Recombinant Transcription initiation factor IIA subunit 2 (toa2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP010000NFSYeast1mgQuote
EP010000NFSE. coli1mgQuote
BP010000NFSBaculovirus200ugQuote
MP010000NFSMammalian Cell200ugQuote

Protein Information

SpeciesNectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
UniProt IDC7ZPG2
Gene Nametoa2; ORFs:NECHADRAFT_50001
Protein NameTranscription initiation factor IIA subunit 2
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceMATGAQSFYELYRRSSIGLALTDTLDDLISDERINPQLAMKILGNFDQAITEALQKNVKA RLQFKGSLDTYRFCDEVWTFLIKNVTFKMDTGGQAVTANKVKIVSCNAKKPEGT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review