Request QuoteCatalog Number: xP340694SVGSize: 0.2-1mg

Request Quote

Recombinant Thioredoxin-3, mitochondrial (TRX3)

Recombinant Thioredoxin-3, mitochondrial (TRX3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340694SVGYeast1mgQuote
EP340694SVGE. coli1mgQuote
BP340694SVGBaculovirus200ugQuote
MP340694SVGMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
UniProt IDP25372
Gene NameTRX3; Locus:YCR083W; ORFs:YCR83W
Protein NameThioredoxin-3, mitochondrial
Region Expressed22-127
Expression Tag6xHis
Purity>90%
AA SequenceSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCD VDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review