Request QuoteCatalog Number: xP517239DOASize: 0.2-1mg

Request Quote

Recombinant Thionin-like protein 1 (At1g12660)

Recombinant Thionin-like protein 1 (At1g12660) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517239DOAYeast1mgQuote
EP517239DOAE. coli1mgQuote
BP517239DOABaculovirus200ugQuote
MP517239DOAMammalian Cell200ugQuote

Protein Information

SpeciesArabidopsis thaliana (Mouse-ear cress)
UniProt IDF4IDU9
Gene NameLocus:At1g12660; ORFs:T12C24.19
Protein NameThionin-like protein 1
Region Expressed24-137
Expression Tag6xHis
Purity>90%
AA SequenceEAVMSFKLCYGGCLVACALIAPPIKKLFCPFLCIKDCKRRPMLSFEANLNEIDQTGSYCE LGCATDRCVSSSSIDDKGYYVNFSGIMWRKFHYAWIHAQKSAPTRTKIAIDFSL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review