Request QuoteCatalog Number: xP023451BOSize: 0.2-1mg

Request Quote

Recombinant TGF-beta receptor type-1 (TGFBR1)

Recombinant TGF-beta receptor type-1 (TGFBR1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP023451BOYeast1mgQuote
EP023451BOE. coli1mgQuote
BP023451BOBaculovirus200ugQuote
MP023451BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDO46680
Gene NameTGFBR1
Protein NameTGF-beta receptor type-1
Region Expressed30-122
Expression Tag6xHis
Purity>90%
AA SequenceLQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTG SITTTYCCNQDHCNKIELPTVGKPSSGLGPVEL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review