HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY
TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein.
Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 97.0% as determined by SDS-PAGE.
It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.
Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution TFPI2 Human should be stored at 4oC between 2-7 days and for future use below -18oC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
TFPI-2, REF1,Placental protein 52.
