Request QuoteCatalog Number: xP020681MOSize: 0.2-1mg

Request Quote

Recombinant Sterile alpha motif domain-containing protein 13 (Samd13)

Recombinant Sterile alpha motif domain-containing protein 13 (Samd13) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020681MOYeast1mgQuote
EP020681MOE. coli1mgQuote
BP020681MOBaculovirus200ugQuote
MP020681MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDD3YUG0
Gene NameSamd13; aka: Gm1652
Protein NameSterile alpha motif domain-containing protein 13
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMLSVDMDNKGNGPVGVKNSMENGRPPDPADWAVTDVVNYFRTAGFEEQACAFQEQEIDGK SLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review