Request QuoteCatalog Number: xP529821CXYSize: 0.2-1mg

Request Quote

Recombinant Sperm-specific class P protein 32 (ssp-32)

Recombinant Sperm-specific class P protein 32 (ssp-32) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529821CXYYeast1mgQuote
EP529821CXYE. coli1mgQuote
BP529821CXYBaculovirus200ugQuote
MP529821CXYMammalian Cell200ugQuote

Protein Information

SpeciesCaenorhabditis elegans
UniProt IDO45433
Gene Namessp-32; ORFs:F32B6.7
Protein NameSperm-specific class P protein 32
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMLTIEPPSATFPASGGSSTHTITSVNESRMAFKVKSSNNEHYRVRPVYGFVEARGKMKFE IIRLEGPVKDDKIMLQYAEVPADETDAQAPFKAGAQQGDVTILLKTN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review