Request QuoteCatalog Number: xP511350NFSSize: 0.2-1mg

Request Quote

Recombinant Signal peptidase complex catalytic subunit SEC11 (SEC11)

Recombinant Signal peptidase complex catalytic subunit SEC11 (SEC11) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511350NFSYeast1mgQuote
EP511350NFSE. coli1mgQuote
BP511350NFSBaculovirus200ugQuote
MP511350NFSMammalian Cell200ugQuote

Protein Information

SpeciesNectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
UniProt IDC7ZHK5
Gene NameSEC11; ORFs:NECHADRAFT_94096
Protein NameSignal peptidase complex catalytic subunit SEC11
Region Expressed1-172
Expression Tag6xHis
Purity>90%
AA SequenceMLSSLGNPRQAAAQLMNFALILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETEVGEVVVYNVKDKDIPIVHRVVRKFGNGDTAELLTKGDNNLSDDTELYA KGQDYLERKDIIGSVVAYMPFVGYVTILLSEHPWLKTVMLGIMGLLVVLQRE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review