Request QuoteCatalog Number: xP001262RASize: 0.2-1mg

Request Quote

Recombinant Serine/threonine-protein kinase receptor R3 (Acvrl1)

Recombinant Serine/threonine-protein kinase receptor R3 (Acvrl1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001262RAYeast1mgQuote
EP001262RAE. coli1mgQuote
BP001262RABaculovirus200ugQuote
MP001262RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP80203
Gene NameAcvrl1; aka: Acvrlk1
Protein NameSerine/threonine-protein kinase receptor R3
Region Expressed21-121
Expression Tag6xHis
Purity>90%
AA SequenceKGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGCGSLNQELCLG RPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review