Request QuoteCatalog Number: xP003124HUSize: 0.2-1mg

Request Quote

Recombinant Serine-rich and transmembrane domain-containing protein 1 (SERTM1)

Recombinant Serine-rich and transmembrane domain-containing protein 1 (SERTM1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP003124HUYeast1mgQuote
EP003124HUE. coli1mgQuote
BP003124HUBaculovirus200ugQuote
MP003124HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA2A2V5
Gene NameSERTM1; aka: C13orf36
Protein NameSerine-rich and transmembrane domain-containing protein 1
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review