Request QuoteCatalog Number: xP325982MOSize: 0.2-1mg

Request Quote

Recombinant Seminal vesicle secretory protein 4 (Svs4)

Recombinant Seminal vesicle secretory protein 4 (Svs4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP325982MOYeast1mgQuote
EP325982MOE. coli1mgQuote
BP325982MOBaculovirus200ugQuote
MP325982MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP18419
Gene NameSvs4; aka: Svp2
Protein NameSeminal vesicle secretory protein 4
Region Expressed22-113
Expression Tag6xHis
Purity>90%
AA SequenceKKTKEKFLQSEETVRESFSMGSRGHMSRSSEPEVFVRPQDSIGDEASEEMSSSSSSRRRS KIISSSSDGSNMEGESSYSKRKKSRFSQDALE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review