Request QuoteCatalog Number: xP014638Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Promotilin (MLN)

Recombinant (Rhesus macaque) Promotilin (MLN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP014638Yeast1mgQuote
EP014638E. coli1mgQuote
BP014638Baculovirus200ugQuote
MP014638Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDO18811
Gene NameMLN
Protein NamePromotilin Cleaved into the following 2 chains: 1. Motilin 2. Motilin-associated peptide
Region Expressed26-115
Expression Tag6xHis
Purity>90%
AA SequenceFVPIFTYGELQRMQEKERSKGQKKSLSVWQRSGEEGPVDPAEPIEEEGNEMIKLTAPLEI GMRMNSRQLEKYRAALEGLLSEMLPQHAAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review