Request QuoteCatalog Number: xP006328Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Cytochrome c (CYCS)

Recombinant (Rhesus macaque) Cytochrome c (CYCS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP006328Yeast1mgQuote
EP006328E. coli1mgQuote
BP006328Baculovirus200ugQuote
MP006328Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDP00002
Gene NameCYCS; aka: CYC
Protein NameCytochrome c
Region Expressed2-105
Expression Tag6xHis
Purity>90%
AA SequenceGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITWG EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review