Request QuoteCatalog Number: xP320748MOSize: 0.2-1mg

Request Quote

Recombinant Retrovirus-related Pol polyprotein (Pol)

Recombinant Retrovirus-related Pol polyprotein (Pol) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP320748MOYeast1mgQuote
EP320748MOE. coli1mgQuote
BP320748MOBaculovirus200ugQuote
MP320748MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP10400
Gene NamePol
Protein NameRetrovirus-related Pol polyprotein Including the following 2 domains: Reverse transcriptase
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequencePSLQAHLQALQAVQREVWKPLAAAYQDQQDQPVIPHPFRVGDTVWVRRHQTKNLEPRWKG PYTVLLTTPTALKVDGIAAWIHAAHVKAATTPPAGTASGPTWKVQRSQNPLKIRLTRGAP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review