P06400

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK
HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH.

The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H₂O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Escherichia Coli.

Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution Retinoblastoma should be stored at 4^oC between 2-7 days and for future use below -18^oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED,PP110, Retinoblastoma-associated protein.