Request QuoteCatalog Number: xP407395HUSize: 0.2-1mg

Request Quote

Recombinant Putative V-set and immunoglobulin domain-containing-like protein IGHV1OR21-1 (IGHV1OR21-1)

Recombinant Putative V-set and immunoglobulin domain-containing-like protein IGHV1OR21-1 (IGHV1OR21-1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP407395HUYeast1mgQuote
EP407395HUE. coli1mgQuote
BP407395HUBaculovirus200ugQuote
MP407395HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA6NJS3
Gene NameIGHV1OR21-1
Protein NamePutative V-set and immunoglobulin domain-containing-like protein IGHV1OR21-1
Region Expressed20-120
Expression Tag6xHis
Purity>90%
AA SequenceQVQLVQSGAEVKKPGASVKVSCKASGYTITSYCMHWVHQVHAQGLEWMGLVCPSDGSTSY AQKFQARVTITRDTSMSTAYMELSSLRSEDTAMYYCVRDTM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review