Request QuoteCatalog Number: xP323665MOSize: 0.2-1mg

Request Quote

Recombinant Putative per-hexamer repeat protein 4 (Phxr4)

Recombinant Putative per-hexamer repeat protein 4 (Phxr4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP323665MOYeast1mgQuote
EP323665MOE. coli1mgQuote
BP323665MOBaculovirus200ugQuote
MP323665MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP15974
Gene NamePhxr4
Protein NamePutative per-hexamer repeat protein 4
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMLCIYVCGVCLCVCFSVCMCVHVLCVYVHVCTYAHIWTTALHLRCLLPKSFSTLLFKAGF GIDTCVIPSFSMGMLVVFMASMLPTEPPPSPWVAH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review