Request QuoteCatalog Number: xP527386BQYSize: 0.2-1mg

Request Quote

Recombinant Putative gene 45 protein (45)

Recombinant Putative gene 45 protein (45) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP527386BQYYeast1mgQuote
EP527386BQYE. coli1mgQuote
BP527386BQYBaculovirus200ugQuote
MP527386BQYMammalian Cell200ugQuote

Protein Information

SpeciesBacillus phage SP01 (Bacteriophage SP01)
UniProt IDO48399
Gene Name45
Protein NamePutative gene 45 protein
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMMMDKQVEEVKKHYPIVEDWSVIVARKEDDCMTVTDAVPFILAGYKNVSYEMDDIVVLCS EPIGLTWEDVRFLKNHEGSVSFEEIGYEDKAMVYHVDLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review