Request QuoteCatalog Number: xP340862TGUSize: 0.2-1mg

Request Quote

Recombinant Protein V2 (V2)

Recombinant Protein V2 (V2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340862TGUYeast1mgQuote
EP340862TGUE. coli1mgQuote
BP340862TGUBaculovirus200ugQuote
MP340862TGUMammalian Cell200ugQuote

Protein Information

SpeciesTomato yellow leaf curl virus (strain Israel) (TYLCV)
UniProt IDP27269
Gene NameORFs:V2
Protein NameProtein V2
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDLISVVRARDYVEATRR YNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHVPKAQNIQNVSKP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review