Request QuoteCatalog Number: xP514390ENUSize: 0.2-1mg

Request Quote

Recombinant Protein TusB (tusB)

Recombinant Protein TusB (tusB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514390ENUYeast1mgQuote
EP514390ENUE. coli1mgQuote
BP514390ENUBaculovirus200ugQuote
MP514390ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZUJ8
Gene NametusB; Locus:BWG_3034
Protein NameProtein TusB
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMLHTLHRSPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAPIKVYALNED LIARGLTGQISNDIILIDYTDFVRLTVKHPSQMAW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review