Request QuoteCatalog Number: xP020958SXVSize: 0.2-1mg

Request Quote

Recombinant Protein transport protein sec61 subunit beta (sbh1)

Recombinant Protein transport protein sec61 subunit beta (sbh1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020958SXVYeast1mgQuote
EP020958SXVE. coli1mgQuote
BP020958SXVBaculovirus200ugQuote
MP020958SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO43002
Gene Namesbh1; ORFs:SPBC2G2.03c
Protein NameProtein transport protein sec61 subunit beta
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMSSTKASGSVKNSAASAPGGPKSQIRRRAAVEKNTKESNSGPAGARAAGAPGSTPTLLKL YTDEASGFKVDPVVVMVLSVGFIASVFLLHIVARILKKFASE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review